SBP-Tag

Das SBP-Tag (von englisch Streptavidin binding peptide tag) ist ein Protein-Tag, das in der Biochemie zur Proteinreinigung und zum -nachweis verwendet wird.

Eigenschaften

Das SBP-Tag wird unter anderem zur Affinitätschromatographie und zu Pulldown-Assays verwendet. Es hat die Aminosäuresequenz MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. Das SBP-Tag wurde per mRNA-Display erzeugt.[1] Die Selektion erfolgte im Hochdurchsatz unter Inkubation von einer Peptid-Bibliothek mit Streptavidin-Agarose und einer Elution mit Biotin. Das SBP-Tag bindet an Streptavidin mit einer Dissoziationskonstante von 2,5 nM.[1][2] Die Elution erfolgt durch Zugabe von Biotin unter nativen Bedingungen.[1][2]

Anwendungen

Das SBP-Tag wird unter anderem als einer der beiden Trennschritte im Zuge einer Tandem Affinity Purification verwendet.[3][4]

Einzelnachweise

David S. Wilson, Anthony D. Keefe, Jack W. Szostak: The use of mRNA display to select high-affinity protein-binding peptides. In: Proceedings of the National Academy of Sciences. 98, Nr. 7, 2001, S. 3750–5. doi:10.1073/pnas.061028198. PMID 11274392. PMC 31124 (freier Volltext).
Anthony D. Keefe, David S. Wilson, Burckhard Seelig, Jack W. Szostak: One-Step Purification of Recombinant Proteins Using a Nanomolar-Affinity Streptavidin-Binding Peptide, the SBP-Tag. In: Protein Expression and Purification. 23, Nr. 3, 2001, S. 440–6. doi:10.1006/prep.2001.1515. PMID 11722181.
Jelle Van Leene, Dominique Eeckhout, Geert Persiau, Eveline Van De Slijke, Jan Geerinck, Gert Van Isterdael, Erwin Witters, Geert De Jaeger: Plant Transcription Factors. Hrsg.: Ling Yuan, Sharyn E. Perry (= Methods in Molecular Biology. Band 754, Nr. 4). 2011, ISBN 978-1-61779-153-6, Isolation of Transcription Factor Complexes from Arabidopsis Cell Suspension Cultures by Tandem Affinity Purification, S. 195–218, doi:10.1007/978-1-61779-154-3_11, PMID 21720954.
Azlinda Anwar, K. M. Leong, Mary L. Ng, Justin J. H. Chu, Mariano A. Garcia-Blanco: The Polypyrimidine Tract-binding Protein Is Required for Efficient Dengue Virus Propagation and Associates with the Viral Replication Machinery. In: Journal of Biological Chemistry. 284, Nr. 25, 2009, S. 17021–9. doi:10.1074/jbc.M109.006239. PMID 19380576. PMC 2719340 (freier Volltext).

This article is issued from Wikipedia. The text is licensed under Creative Commons - Attribution - Sharealike. The authors of the article are listed here. Additional terms may apply for the media files, click on images to show image meta data.

[Wilson_et_al_2001-1] David S. Wilson, Anthony D. Keefe, Jack W. Szostak: The use of mRNA display to select high-affinity protein-binding peptides. In: Proceedings of the National Academy of Sciences. 98, Nr. 7, 2001, S. 3750–5. doi:10.1073/pnas.061028198. PMID 11274392. PMC 31124 (freier Volltext).

[Keefe_et_al_2001-2] Anthony D. Keefe, David S. Wilson, Burckhard Seelig, Jack W. Szostak: One-Step Purification of Recombinant Proteins Using a Nanomolar-Affinity Streptavidin-Binding Peptide, the SBP-Tag. In: Protein Expression and Purification. 23, Nr. 3, 2001, S. 440–6. doi:10.1006/prep.2001.1515. PMID 11722181.

[Van_Leene_et_al_2011-3] Jelle Van Leene, Dominique Eeckhout, Geert Persiau, Eveline Van De Slijke, Jan Geerinck, Gert Van Isterdael, Erwin Witters, Geert De Jaeger: Plant Transcription Factors. Hrsg.: Ling Yuan, Sharyn E. Perry (= Methods in Molecular Biology. Band 754, Nr. 4). 2011, ISBN 978-1-61779-153-6, Isolation of Transcription Factor Complexes from Arabidopsis Cell Suspension Cultures by Tandem Affinity Purification, S. 195–218, doi:10.1007/978-1-61779-154-3_11, PMID 21720954.

[Anwar_et_al_2009-4] Azlinda Anwar, K. M. Leong, Mary L. Ng, Justin J. H. Chu, Mariano A. Garcia-Blanco: The Polypyrimidine Tract-binding Protein Is Required for Efficient Dengue Virus Propagation and Associates with the Viral Replication Machinery. In: Journal of Biological Chemistry. 284, Nr. 25, 2009, S. 17021–9. doi:10.1074/jbc.M109.006239. PMID 19380576. PMC 2719340 (freier Volltext).